SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007440 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007440
Domain Number 1 Region: 33-132
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-21
Family V set domains (antibody variable domain-like) 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007440   Gene: ENSPTRG00000004337   Transcript: ENSPTRT00000008060
Sequence length 215
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:116176887:116188007:-1 gene:ENSPTRG00000004337 transcript:ENSPTRT00000008060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALT
VTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGT
YTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRK
KRWAERAHKVVEIKSKEEERLNQEKKVPVYLEDTD
Download sequence
Identical sequences H2Q4V8
9598.ENSPTRP00000007440 ENSPTRP00000007440 ENSPTRP00000007440 XP_009422528.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]