SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007526 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007526
Domain Number 1 Region: 51-290
Classification Level Classification E-value
Superfamily L domain-like 1.81e-25
Family Internalin LRR domain 0.022
Further Details:      
 
Domain Number 2 Region: 337-422
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.95e-16
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007526   Gene: ENSPTRG00000004395   Transcript: ENSPTRT00000008153
Sequence length 424
Comment pep:known chromosome:CHIMP2.1.4:11:118990847:119056932:1 gene:ENSPTRG00000004395 transcript:ENSPTRT00000008153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGI
TCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERT
CAGSFSGVRKLVLNNSKASWETVHTILQELPDLEELFLCLNDYETVSCPSICCHSLKLLH
ITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQ
SWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDS
ERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIR
LDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVE
SKTK
Download sequence
Identical sequences A0A0D9S400 A0A2K5F6B0 A0A2K5KCW8 A0A2K5P7U9 A0A2K5PM07 A0A2K5XRY5 A0A2K6CHA2 A0A2K6K8N4 A0A2K6QZ50 A0A2K6TTV0 D2GYB4 F7HAJ3 G1R758 G3SCP5 G7PPC2 K7DPT1 M3WIY1
ENSFCAP00000012509 ENSMMUP00000000114 ENSMMUP00000000114 ENSAMEP00000008615 ENSNLEP00000009030 ENSPTRP00000007526 NP_001253301.1.72884 XP_002914122.1.58354 XP_003253340.1.23891 XP_003253341.1.23891 XP_003820023.1.60992 XP_003923636.1.74449 XP_003992496.1.62641 XP_004417280.1.74151 XP_004417281.1.74151 XP_006734385.1.47382 XP_006734386.1.47382 XP_007072934.1.5354 XP_008019419.1.81039 XP_008019420.1.81039 XP_008019421.1.81039 XP_008019422.1.81039 XP_008688180.1.72690 XP_008688181.1.72690 XP_008688182.1.72690 XP_010332725.1.74449 XP_010355304.1.97406 XP_010355305.1.97406 XP_010355306.1.97406 XP_010355307.1.97406 XP_011730468.1.29376 XP_011730469.1.29376 XP_011730470.1.29376 XP_011730471.1.29376 XP_011730472.1.29376 XP_011730473.1.29376 XP_011782370.1.43180 XP_011782371.1.43180 XP_011782372.1.43180 XP_011820368.1.47321 XP_011820369.1.47321 XP_011820370.1.47321 XP_011908533.1.92194 XP_011908534.1.92194 XP_012325705.1.9421 XP_012325706.1.9421 XP_012351234.1.23891 XP_014927554.1.86478 XP_017379049.1.71028 XP_017379051.1.71028 XP_017721047.1.44346 XP_017721049.1.44346 XP_017721050.1.44346 XP_017721051.1.44346 XP_018893188.1.27298 XP_018893189.1.27298 XP_019324399.1.44245 XP_019324400.1.44245 XP_021552060.1.83697 ENSAMEP00000008615 ENSPTRP00000007526 ENSNLEP00000009030 9544.ENSMMUP00000000114 9598.ENSPTRP00000007526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]