SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007528 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007528
Domain Number 1 Region: 594-652
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000343
Family BSTI 0.039
Further Details:      
 
Domain Number 2 Region: 979-1038
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000703
Family BSTI 0.055
Further Details:      
 
Domain Number 3 Region: 1368-1427
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000719
Family ATI-like 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000007528
Domain Number - Region: 2085-2126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00285
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 254-307
Classification Level Classification E-value
Superfamily FnI-like domain 0.00701
Family Fibronectin type I module 0.032
Further Details:      
 
Domain Number - Region: 643-697
Classification Level Classification E-value
Superfamily FnI-like domain 0.0983
Family Fibronectin type I module 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007528   Gene: ENSPTRG00000004396   Transcript: ENSPTRT00000008155
Sequence length 2155
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:119069962:119155850:1 gene:ENSPTRG00000004396 transcript:ENSPTRT00000008155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYSSFLRIWVSFIFALVRHQAQPRELMYPFWQNDTKTPKVDDGSSSEIKLAIPVFFFGV
PYRTVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFIAPFWADVHNGIRGEIYYRETMDPA
ILKRATKDIRKYFKDMATFSATWVFIVTWEEVTFYGGSSTTPVNTFQAVLVSDGSYTFTL
FNYYEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFSLPGSRTPEIVNIQETTNVN
VPGRWAFKVDGKEIDPANGCTSRGQFLRRGEVFWDDLNCTVKCRCLDFNNEIYCQEASCS
PYEVCEPKGKFFYCSAVETSTCVVFGEPHYHTFDGFLFHFQGSCAYLLARQCLQTSSLPF
FSVEAKNEHRGGSAVSWVKELSVEVNGYKILIPKGSYGKVKVNDLVTSLPVTLDLGTVKI
YQSGISTAVETDFGLLVTFDGQHYASISVPGSYINSTCGLCGNYNKNPLDDFLRPDGRPA
MSVLDLGESWRVYHTDWKCDSGCVDNCTQCDAATEALYFGSDYCGFLNKTDGPLWECGTV
VDPTAFVHSCVYDLCSVRDNGTLLCQAIQAYALVCQALGIPIGDWRTQTGCVSTVQCPSF
SHYSVCTSSCPDTCSDLTASRNCATPCTEGCECNQGFVLSTSQCVPLHKCGCDFDGHYYT
MGEFFWATANCTVQCLCEEGGDVYCFNKTCGSGEVCAVEDGYQGCFPTRETVCLLSQNQV
LHTFDGASYAFPSEFSYTLLKTCPERPEYLEIDINKKKPDAGPAWLRGLRILVADQEVKI
GGIGASEVKLNGQEVELPFFHPSGKLEIYRNKNSTTVESKGVVTVQYSDIGLLYIRLSTT
YFNCTGGLCGFYNANASDEFCLPNGKCTDNLAVFLESWTTFEEICNGECGDLLKACNNDS
ELLKFYRSRSRCGIINDPSNSSFLECHGVVNVTAYYRTCLFRLCQSVGNESELCDSVARY
ASACKNADVEVGPWRTYDFCPLECPENSHFEECITCTETCETLALGPICVDSCSEGCQCD
EGYALLGSQCVTRSECGCNFEGHQLATNETFWVDLDCQIFCYCNGTDNRVHCETIPCKDD
EYCMEEGGLYYCQARTDASCIVSGYGHYLTFDGFPFDFQTSCPLILCTTGSRPSSDSFPK
FVVTAKNEDRDPSLALWVKQVDVTVFGYSIVIHRAYKHTVLVNSERLYLPLKLGQGKINI
FSFGFHVVVETDFGLKVVYDWKTFLSITVPRSMQNSTYGLCGRYNGNPDDDLEMPMGLLA
SSVNEFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVQQLCSLIPNQNAAFSKCHSKVNP
TFFYKNCLFDSCIDGGAVQTACSWLQNYASTCQTQGITVTGWRNYTSCTVTCPPNSHYES
CVSVCQPRCAAIRLKSDCSHYCVEGCQCDAGYVLNGKSCILPHSCGCYSDGKYYEPKQLF
WNSDCTRRCRCFRRNLIQCDPRQCKSDEECALRNGVRGCFSTKTSYCLAAGGGVFRTFDG
AFLRFPANCAFVLSTICQKLPDISFQLIINFDKWSAPNLTIVSPVYFYINEEQILINDRN
TVKVNGTQVNVPFITGLATKIYSSEGFLVIDTSPDIQIYYNGFNVIKISISERLQNKVCG
LCGNFNGDLTDDYVTLRGKPVVSSVVLAQSWKTNGLQKRPLAPSCNELQFSQYAAMCDNV
HIQKMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCYLDGCYNHKKFQLCGSLAAYGEA
CRSFGILSTEWIEKENCSGVVEDPCVGADCPNRTCELGNGRELCGCIEPPPYGNNSHDII
DAEVTCKAAQMEVSISKCKLFQLGFEREGVRINDRQCTGIEGEDFISFQINNTKGNCGNI
VQSNGTHIMYKNTLWIESANNTGNIITRDRTINVEFSCAYELDIKISLDSVVKPMLSVIN
LTVPTQEGSFITKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADATHLILTLNKC
YATPTRDSNDKLRYFIIEGGCQNLKDNTIGIEENAVSLTCRFHVTVFKFIGDYDEVHLHC
AVSLCDSEKYSCKITCPHNSRIATDYTKEPKEQIISVGPIRRKRLDWCEDNGGCEQICTS
RVDGPLCSCVTGTLQEDGKSCRASNSSIELQVWTLLLIMIQISLWHFVYKSATTS
Download sequence
Identical sequences A0A2J8N222
ENSPTRP00000007528 9598.ENSPTRP00000007528 ENSPTRP00000007528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]