SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007572 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007572
Domain Number 1 Region: 149-245
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000339
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 41-156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000157
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007572   Gene: ENSPTRG00000004429   Transcript: ENSPTRT00000008206
Sequence length 390
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:122731997:122741193:-1 gene:ENSPTRG00000004429 transcript:ENSPTRT00000008206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEV
SSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKD
SGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPRVGANVTLSCQSPRSK
PAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLE
VSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKS
SDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISP
IPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
Download sequence
Identical sequences H2Q516
ENSPTRP00000007572 XP_003819981.1.60992 XP_508839.1.37143 9598.ENSPTRP00000007572 ENSPTRP00000007572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]