SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007679 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007679
Domain Number 1 Region: 219-312
Classification Level Classification E-value
Superfamily Immunoglobulin 6.67e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 38-139
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-17
Family I set domains 0.037
Further Details:      
 
Domain Number 3 Region: 127-208
Classification Level Classification E-value
Superfamily Immunoglobulin 8.34e-17
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007679   Gene: ENSPTRG00000004489   Transcript: ENSPTRT00000008316
Sequence length 345
Comment pep:known chromosome:CHIMP2.1.4:11:130483731:131011632:-1 gene:ENSPTRG00000004489 transcript:ENSPTRT00000008316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTID
DRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTD
NHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGF
VSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKG
ILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATN
KLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF
Download sequence
Identical sequences A0A2J8N0Y2 A0A2J8WZB9 A8K0Y0 G3SF73 Q14982 Q5IS61
9598.ENSPTRP00000007679 9606.ENSP00000330862 ENSP00000330862 NYSGRC-IgSF-OPCM_HUMAN ENSPTRP00000007679 ENSP00000330862 ENSP00000482061 ENSGGOP00000000426 gi|4505505|ref|NP_002536.1| ENSPTRP00000007679 NP_001012438.1.37143 NP_002536.1.87134 NP_002536.1.92137 XP_004052505.1.27298 XP_008971515.1.60992 ENSGGOP00000000426 ENSGGOP00000026757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]