SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007693 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007693
Domain Number 1 Region: 51-366
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.65e-98
Family Glycosyl hydrolases family 35 catalytic domain 0.0000651
Further Details:      
 
Domain Number 2 Region: 484-620
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.66e-27
Family Beta-galactosidase LacA, domains 4 and 5 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007693   Gene: ENSPTRG00000004499   Transcript: ENSPTRT00000008330
Sequence length 636
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:132431993:132479764:1 gene:ENSPTRG00000004499 transcript:ENSPTRT00000008330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTWSLRRRPARTLGLLLLVVLGFLVLRRLDWSTLVPLRLRHRQLGLQAKGWNFVLEGST
FWIFGGSIHYFRVPREYWRDRLLKMKACGLNTLTTYVPWNLHEPERSKFDFSGNLDLEAF
VLMAAEIGLWVILRPGPYICSEMDLGGLPSWLLQDPGMRLRTTYKGFTEAVDLYFDHLMS
RVVPLQYKRGGPIIAVQVENEYGSYNKDPAYMPYVKKALEDRGIVELLLTSDNKDGLSKG
IVQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWTGWFDSWGGPHNILDSSEVLK
TVSAIVDAGSSINLYMFHGGTNFGFMNGAMHFHDYKSDVTSYDYDAVLTEAGDYTAKYMK
LRDFFGSISGIPLPPPPDLLPKMPYEPVTPVLYLSLWDALKYLGEPIKSEKPINMENLPV
NGGNGQSFGYVLYETGITSPGILSGRVHDRGQVFVNTVSIGFLDYKTTKIALPLIQGYTV
LRILVENRGRVNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSS
LPETPTLPAFFLGSLSISSTPCDTFLKLEGWEKGVVFINGQNLGRYWNIGPQKTLYLPGP
WLSSGINQVIIFEETMAGPALQFTETPHLGRNQYIK
Download sequence
Identical sequences A0A2J8N0T9
ENSPTRP00000007693 ENSPTRP00000007693 9598.ENSPTRP00000007693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]