SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007730 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007730
Domain Number 1 Region: 68-386
Classification Level Classification E-value
Superfamily RNI-like 3.22e-42
Family 28-residue LRR 0.051
Further Details:      
 
Domain Number 2 Region: 9-44
Classification Level Classification E-value
Superfamily F-box domain 0.0000311
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007730   Gene: ENSPTRG00000004518   Transcript: ENSPTRT00000008367
Sequence length 406
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:1618170:1646548:-1 gene:ENSPTRG00000004518 transcript:ENSPTRT00000008367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLFGFLIFGLRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRR
VQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITD
SSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAG
MTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLSHM
GSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSL
CSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKR
GLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSSRR
Download sequence
Identical sequences ENSPTRP00000007730 ENSPTRP00000007730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]