SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007737 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007737
Domain Number 1 Region: 50-249
Classification Level Classification E-value
Superfamily L domain-like 3.74e-40
Family Ngr ectodomain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007737   Gene: ENSPTRG00000004523   Transcript: ENSPTRT00000008374
Sequence length 370
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:1880838:1897288:1 gene:ENSPTRG00000004523 transcript:ENSPTRT00000008374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAPGSSPEQRGRLALQWRQVSWITCWIALYAVEALPTCPFSCKCDSRSLEVDCSGLGLT
TVPPDVPAATRTLLLLNNKLSALPSWAFANLSSLQRLDLSNNFLDRLPRSIFGDLTNLTE
LQLRNNSIRTLDRDLLRRSPLLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLD
RLTFEPLANLQLLQVGDNPWECDCNLREFKHWMEWFSYRGGRLDQLACTLPKELRGKDMR
MVPMEMFNYCSQLEDENSSAGLDIPGPPCTKASPEPAKPKPGAEPEPEPSTACPQKQRHR
PASVRRAMGTVIIAGVVCGVVCIMMVVAAAYGCIYASLMAKYHRELKKRQPLMGDPEGEH
EDQKQISSVA
Download sequence
Identical sequences ENSPTRP00000007737 ENSPTRP00000007737 9598.ENSPTRP00000007737 XP_003820414.1.60992 XP_003820415.1.60992 XP_008972047.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]