SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007801 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007801
Domain Number 1 Region: 1465-1659
Classification Level Classification E-value
Superfamily vWA-like 6.68e-46
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 2 Region: 1271-1462
Classification Level Classification E-value
Superfamily vWA-like 3.34e-44
Family Integrin A (or I) domain 0.0000000108
Further Details:      
 
Domain Number 3 Region: 1651-1872
Classification Level Classification E-value
Superfamily vWA-like 6.83e-39
Family Integrin A (or I) domain 0.000000034
Further Details:      
 
Domain Number 4 Region: 648-709
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000141
Family ATI-like 0.097
Further Details:      
 
Domain Number 5 Region: 294-348
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000311
Family BSTI 0.041
Further Details:      
 
Domain Number 6 Region: 773-829
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000101
Family ATI-like 0.025
Further Details:      
 
Domain Number 7 Region: 2198-2254
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000474
Family ATI-like 0.07
Further Details:      
 
Domain Number 8 Region: 1143-1196
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000262
Family ATI-like 0.041
Further Details:      
 
Domain Number 9 Region: 2570-2650
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000377
Family VWC domain 0.062
Further Details:      
 
Domain Number 10 Region: 827-893
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000847
Family VWC domain 0.083
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000007801
Domain Number - Region: 2423-2499
Classification Level Classification E-value
Superfamily FnI-like domain 0.000879
Family VWC domain 0.068
Further Details:      
 
Domain Number - Region: 699-740
Classification Level Classification E-value
Superfamily FnI-like domain 0.00513
Family VWC domain 0.034
Further Details:      
 
Domain Number - Region: 440-512
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0549
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007801   Gene: ENSPTRG00000004566   Transcript: ENSPTRT00000008444
Sequence length 2813
Comment pep:novel chromosome:CHIMP2.1.4:12:6085780:6265741:-1 gene:ENSPTRG00000004566 transcript:ENSPTRT00000008444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPARFARVLLALALILPGTLCAEGTRGRSSMARCSLFGNDFVNTFDGSMYSFAGYCSYL
LAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYL
ETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTL
TSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPL
VDPEPFVALCEKTLCECAGGLECACPAFLEYARTCAQEGMVLYGWTDHSACSPVCPAGME
YKQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPG
ASLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQD
HSFSIVIETVQCADDRDAVCTRSVTVRLRGLHNSLVKLKHGAGVAMDGQDVQLPLLKGDL
RIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSG
LAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVS
PLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVSVAWREPGRCELNCPKGQVYLQ
CGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPED
IFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADN
LQAEGLECAKTCQNYDLECMSMGCVSGCLCPPGMVRHGNRCVALERCPCFHQGKEYAPGE
TVKIGCNTCVCRDRKWNCTDHVCDATCSMIGMAHYLTFDGLKYLFPGECQYVLVQDYCGS
NPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGR
YIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVD
FGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPY
LDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGY
ECEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPKDCPVCE
VAGRRFASGKKVTLNPSDPEHCQICHCDGVNLTCEACQEPGGLVVPPTDGPVSPTTPYVE
DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVE
YHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRI
ALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVL
SGVDELEQQRDEIVSYLCDLAPEAPPPTLPPHVAQVTVGLGLLGLSTLGPKRNSMVLDVA
FVLEGSDKIGEADFNRSKEFMEEVIQRMDVGQDSIHVTVLQYSYMVTVEYPFSEAQSKGD
ILQRVREIRYQGGNRTNTGLALRYLSDHSFLVSQGDREQAPNLVYMVTGNPASDEIKRLP
GDIQVVPIGVGPNANVQELERIGWPNAPILIQDFESLPREAPDLVLQRCCSGEGLQIPTL
SPASDCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITT
IDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILV
TDVSVDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTM
VTLGNSFLHKLCSGFVRICMDEDGNEKRPGDVWTLPDQCHTVTCQPDGQTLLKSHRVNCD
RGLRPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNK
EQDLEVILHNGACSPGARQGCMKSIEVKHSALSVELHSDMEVTVNGRLVSVPYVGGNMEV
NVYGAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRD
GTVTTDWKTLVQEWTVQRPGQTCQPILEEQCLVPNSSHCQVLLLPLFAECHKVLAPATFY
AICQQDSCHQEQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNHCEHGCPRHC
DGNVSSCGDHPSEGCFCPPDKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQI
CTCLSGRKVNCTTQPCPTAKAPTCGLCEVARLRQNADQCCPEYECVCDPVSCDLPPVPHC
ERGLQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRLPTLRKTQCCDEYECACNCVN
STVSCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDVV
MGLRVAQCSQKPCEDSCRSGFTYVLHEGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSQ
WASPENPCLINECVRVKEEVFIQQRNVSCPQLEVPVCPSGFQLNCKTSACCPSCRCERME
ACMLNGTVIGPGKTVMIDVCTTCRCMVQVGVISGFKLECRKTTCNPCPLGYKEENNTGEC
CGRCLPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHK
CLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMY
SIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Download sequence
Identical sequences ENSPTRP00000007801 9598.ENSPTRP00000007801 ENSPTRP00000007801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]