SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007855 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007855
Domain Number 1 Region: 73-312
Classification Level Classification E-value
Superfamily L domain-like 2.01e-33
Family Internalin LRR domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007855   Gene: ENSPTRG00000004597   Transcript: ENSPTRT00000008502
Sequence length 343
Comment pep:known chromosome:CHIMP2.1.4:12:7074032:7084148:1 gene:ENSPTRG00000004597 transcript:ENSPTRT00000008502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEDDLEDSEPDQDDSEKEEDEKETEEGEDYRKEGEEFPEEWLPTPLTEDMMKEGLSLL
CKTGNGLAHAYVKLEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKA
DGNRLRSAQMNELPYLQIASFAYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLIS
LHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLHLRDNQIDTLSGF
SREMKSLQYLNLRGNMVADLGELAKLRDLPKLRALVLLDNPCTDETSYRQEALVQMPYLE
RLDKEFYEEEERAEADEIRQRLKEEKEQEPEPQRDLEPEQSLI
Download sequence
Identical sequences A0A2I3RRF3
XP_003820318.1.60992 XP_003820319.1.60992 XP_008971912.1.60992 XP_009422994.1.37143 XP_009422995.1.37143 XP_009422996.1.37143 9598.ENSPTRP00000007855 ENSPTRP00000007855 ENSPTRP00000007855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]