SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000007963 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000007963
Domain Number 1 Region: 46-198
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-35
Family C-type lectin domain 0.000000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000007963   Gene: ENSPTRG00000004659   Transcript: ENSPTRT00000008619
Sequence length 199
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:9936531:9944943:-1 gene:ENSPTRG00000004659 transcript:ENSPTRT00000008619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL
AVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSEKCVFLKNTE
VSSMECEKNLYWICNKPYK
Download sequence
Identical sequences H2Q5E4
ENSPTRP00000007963 9598.ENSPTRP00000007963 XP_003829696.1.60992 XP_520732.2.37143 ENSPTRP00000007963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]