SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008312 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008312
Domain Number 1 Region: 137-406
Classification Level Classification E-value
Superfamily EndoU-like 1.57e-95
Family Eukaryotic EndoU ribonuclease 0.0000067
Further Details:      
 
Domain Number 2 Region: 21-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000000209
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 88-128
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000353
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008312   Gene: ENSPTRG00000004863   Transcript: ENSPTRT00000009000
Sequence length 411
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:41650189:41666053:1 gene:ENSPTRG00000004863 transcript:ENSPTRT00000009000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACISLVLAVLCGLAWAGKIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTE
DHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDF
ESLCSDHEGFSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVD
RCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAV
MKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGF
HNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFA
LYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST
Download sequence
Identical sequences H2Q5S4
ENSPTRP00000008312 XP_003825823.1.60992 XP_522366.2.37143 ENSPTRP00000008312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]