SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008514 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008514
Domain Number 1 Region: 49-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-16
Family SPRY domain 0.051
Further Details:      
 
Domain Number 2 Region: 244-333
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000138
Family SPRY domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008514   Gene: ENSPTRG00000005000   Transcript: ENSPTRT00000009208
Sequence length 342
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:36190935:36203799:1 gene:ENSPTRG00000005000 transcript:ENSPTRT00000009208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHG
NSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHA
DDGKLYNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPD
GLFPAVGMHSLGEEVRLHLNAELGREDDSVMMVDSYEDEWGRLHDVRVCGTLLEYLGKGK
SIVDVGLAQARHPLSTRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHA
DDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGE
Download sequence
Identical sequences ENSPTRP00000008514 ENSPTRP00000008514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]