SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008670 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008670
Domain Number 1 Region: 317-567
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.91e-91
Family STAT DNA-binding domain 0.000000496
Further Details:      
 
Domain Number 2 Region: 139-316
Classification Level Classification E-value
Superfamily STAT 4.71e-45
Family STAT 0.00015
Further Details:      
 
Domain Number 3 Region: 568-686
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-40
Family SH2 domain 0.0000253
Further Details:      
 
Domain Number 4 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.27e-33
Family Transcription factor STAT-4 N-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008670   Gene: ENSPTRG00000005095   Transcript: ENSPTRT00000009371
Sequence length 851
Comment pep:known chromosome:CHIMP2.1.4:12:32998667:33016656:1 gene:ENSPTRG00000005095 transcript:ENSPTRT00000009371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILI
QAQRAQSEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPPKAPWSFLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTISGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELES
LELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDRG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF
YTDGPLMPSDF
Download sequence
Identical sequences A0A2I3TRE4
9598.ENSPTRP00000008670 ENSPTRP00000008670 ENSPTRP00000008670 XP_001168971.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]