SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008732 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008732
Domain Number 1 Region: 264-400,435-644
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.28e-88
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000449
Further Details:      
 
Domain Number 2 Region: 650-818
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.05e-37
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0001
Further Details:      
 
Domain Number 3 Region: 80-188
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000000273
Family Glutathione S-transferase (GST), C-terminal domain 0.0062
Further Details:      
 
Domain Number 4 Region: 842-894
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.000000000000432
Family a tRNA synthase domain 0.0022
Further Details:      
 
Domain Number 5 Region: 401-435
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0000000000693
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000008732
Domain Number - Region: 1-69
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00883
Family Glutathione S-transferase (GST), N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008732   Gene: ENSPTRG00000005135   Transcript: ENSPTRT00000009437
Sequence length 900
Comment pep:known chromosome:CHIMP2.1.4:12:31836286:31864013:-1 gene:ENSPTRG00000005135 transcript:ENSPTRT00000009437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFVSEGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRA
LTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQE
PCQRAAETVLKQQGVLALRPYLQKQPQPSPTEGRAVTNEPEEEELATLSEEEIAMAVTAW
EKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNISFDIFGRTTTP
QQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINAVELKKPQCKVCRSCPVVQSTQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQF
ITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWW
KNPEQVDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMF
VSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVRIRDALRSILTISRHGNQYIQ
VNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSI
LLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTARPQ
QIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK
Download sequence
Identical sequences H2Q6B5
XP_009423338.1.37143 ENSPTRP00000008732 ENSPTRP00000008732 9598.ENSPTRP00000008732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]