SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008765 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008765
Domain Number 1 Region: 201-318
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 4.19e-24
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000237
Further Details:      
 
Domain Number 2 Region: 99-207
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.13e-21
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000145
Further Details:      
 
Domain Number 3 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000201
Family TS-N domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008765   Gene: ENSPTRG00000005152   Transcript: ENSPTRT00000009476
Sequence length 325
Comment pep:known chromosome:CHIMP2.1.4:12:31548138:31563727:-1 gene:ENSPTRG00000005152 transcript:ENSPTRT00000009476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLRSLRVFLVARTGSHPAGSLLRQSPQPRHTFHAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSTYSKGFLNSSELSGLPAGPDREG
SLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVIC
ETSEQKTNLEDVGRRLGQHVVGMAPLTVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYV
QPQGVSVVDFVRFECGEGEEAAETE
Download sequence
Identical sequences A0A2I3S0L7
XP_003824876.1.60992 XP_016778635.1.37143 ENSPTRP00000008765 ENSPTRP00000008765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]