SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008803 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000008803
Domain Number - Region: 276-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000158
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 246-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000404
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 214-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000816
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 181-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 310-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008803   Gene: ENSPTRG00000005179   Transcript: ENSPTRT00000009517
Sequence length 379
Comment pep:known chromosome:CHIMP2.1.4:12:24131943:24204180:1 gene:ENSPTRG00000005179 transcript:ENSPTRT00000009517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSE
GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILQTPQNAIFFKTCQQA
ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVN
CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY
QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYGASLIHALRPAGAQLRQHT
PSLKKAEERRDPPESNYIW
Download sequence
Identical sequences H2Q6E5
9598.ENSPTRP00000008803 ENSPTRP00000008803 XP_001163469.1.37143 XP_003824845.1.60992 ENSPTRP00000008803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]