SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008874 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008874
Domain Number 1 Region: 48-323
Classification Level Classification E-value
Superfamily L domain-like 2.62e-56
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 244-482
Classification Level Classification E-value
Superfamily L domain-like 1.29e-40
Family Ngr ectodomain-like 0.022
Further Details:      
 
Domain Number 3 Region: 547-848
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.1e-33
Family Rhodopsin-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008874   Gene: ENSPTRG00000005223   Transcript: ENSPTRT00000009606
Sequence length 907
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:71252630:71401188:1 gene:ENSPTRG00000005223 transcript:ENSPTRT00000009606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSRLGVLLSLPVLLQLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM
LQNNQLRQVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA
FQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS
YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFST
LPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQVQDERDLEDFLLDFEEDLKALHSVQ
CSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTSTVFRSPLYISPIKLLIGVIA
AVNMLTGVSSAVLAGVDAFTFGSFARHGAWWENGVGCHVIGFLSIFASESSVFLLTLAAL
ERGFSVKYSAKFETKAPFSSLKVIILLCALLALTMAAVPLLGGSKYGTSPLCLPLPFGEP
STMGYMVALILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIALLLFTNCILYC
PVAFLSFSSLINLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLGKQTYF
WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSS
VAFVPCL
Download sequence
Identical sequences A0A2I3STB8
ENSPTRP00000008874 XP_003313909.1.37143 ENSPTRP00000008874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]