SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008931 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008931
Domain Number 1 Region: 1172-1354
Classification Level Classification E-value
Superfamily AbfB domain 3.53e-31
Family AbfB domain 0.0078
Further Details:      
 
Domain Number 2 Region: 734-791
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000932
Family BSTI 0.067
Further Details:      
 
Domain Number 3 Region: 377-436
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000262
Family ATI-like 0.019
Further Details:      
 
Domain Number 4 Region: 832-900
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000801
Family ATI-like 0.026
Further Details:      
 
Domain Number 5 Region: 1795-1855
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000101
Family BSTI 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000008931
Domain Number - Region: 1365-1418
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000719
Family BSTI 0.053
Further Details:      
 
Domain Number - Region: 434-475
Classification Level Classification E-value
Superfamily FnI-like domain 0.0046
Family Fibronectin type I module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008931   Gene: ENSPTRG00000005257   Transcript: ENSPTRT00000009666
Sequence length 2344
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:80219078:80379897:1 gene:ENSPTRG00000005257 transcript:ENSPTRT00000009666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPWSIFLLHVLLFSLQEYVCASSILMGTSKNGFNENRQKRALLAAQFEATSPRYFFHDA
INWGESKIKGSCPYECLNGAFCSKTGTCDCQIFQALGTRCQIIPNMGNGRDGICKTWGQY
HFETFDGIYYYFPGNCSYIFAKDCGDLEPRYTVWVHNSPKCLGSVYSCYRSISLFFSNQE
EIRIYGHEIKKNGISLTLPQTIGQIFIEKLADYILVKTTFGFSLAWDGISGIYLKLSEDH
KGKSCGLCGNYNDIQSDDFIILQEDYTEDIAMFANSWSVQTPDDTKCVLTPSDFPNPCSS
GMPAFEAIFFKCQILLQFPFLSCHEYIDPYLYIASCVNDLCKTDDDETYCRAATEYARAC
SHAGYPIQDWRDDFPACTDKCDDSFVHRDCISCCPPTCTFEKQCLGSNLHCLDGCYCPDG
LVMDNGTCISLENCPCGFHGLAYSVGSKIEQECTECVCVGGVWNCTEQDCPVQCSVVGDS
HFTTFDGRHYSFIGMCQYILVKGTGKDKFTITLQKAPCEQNLGLVCLQSITLILEDDFNK
QVTLGRGGQILTSPNQGFNLNGIVEIQTLSSLFILLKTTFGLKILFAIDGERIYIQLTSA
WKRRTLGLCGTFNGNIRDDFLSPSGMIEGTPQLHANAWRVSSTCFAPVHVPMVDPCNINQ
QNIGYAAHCDVIHQELFAPCHIYISPGLYYQLCRHDACKCGSSCLCNALAHYAYLCGQHG
VPIDFRTQISFCAVVCQKGMLYHHCSSFCLHSCISLSSPEQCSDDCAEGCNCPEGKFYED
TLNFCVPIFHCRCHYRGSVYQPGELIPTPSGLCQCSNGTVKCDELATPSAVHICPEGKEY
FDCRFPDPELPAGGVNCETTCANLAMNFTCTPSSPCISGCVCAPGMAEHRGKCYVPESCP
CIWKDWEYLSGEVIATPCYTCVCRRGMFNCTYYPCPAVCTIYGDRHYYSFDGLEYDYISD
CQVFLIKSADDSDISVIAQNKKCFDNDIVCSKSVLISVGDTEIYLNDTPYKQKQSGFFLE
NKSTYQLWKAGYYIVVYFPEKDITILWDRKTTIHIKVGPQWKNKLSGLCGNFDKCTSNDM
TTSNNLEVRNAQVFGDSWALGQCESPDETIKPCEAHQNKFPYAKKECSILYSDIFASCRN
VIDVTSFAKNCHEDTCNCNLGGDCECLCTSIAAYAYKCCQEGISIHWRSSTVCSLDCEYY
NEGLGEGPYMLASYGQSGLVLGANMTSRSVFCLPRSSVHTSLFFYFMITPGLFKEKVSSL
ALVSLESAERPNYFLYVHDNDTLSLELWEANSAFHRRATFFHHQGLWIPGYSAFELHSKK
GFFIIFTDSSVKASKYDDSEEFKHSSSFSIEEIQAAVPYRKMCEWRYEPCATPCFKTCSD
PEALACKFLPPVEGCLPYCPKNMILDEVTLKCVYPGDCIPVIPAEPTLMPPAKPTVPMFT
VWEMITPSDITVFDMLTPTTGLECEPQKFDPVYDCSQYICLNMEWQLYNWSLNCPKDVEM
PDCGFRGRPVQVNSDICCPEWECPCRCSMLSELSIITFDGNNAALYSMASYILVRIPGEI
IVAHIEKCSMNQNGNSLKKLAPSGRISGLCFKKLNVTTPIHKIIVNRLARKVEVDSIVVP
LPFSSQELSIEDSGSMYVITTPAGLIIKWSHLTGIIDIHFGFRFNLSSYTEGLCGICNED
PDDDLRMQNGTIITNMEDIGLFIESWEIEKSFEVTMRRPVRNCTEHDCSQCIDLLNRRIF
IPCHDKVSPEDFCEKMWINYTYFWNYECDALSAYVALCNKFDICIQWRTPDYCSLSCPEG
KEYQPCVRPCEARTCLNQWFYGHTSCLNLREDCVCKDGTILHRPHSTQCIPEKECACTDS
EDQPRTAGEIWNGGIDECALYKCLENGSIIPIEPDCDEEPMPVCEREAEVVMGIIDKWTC
CSKEVCGCDTTLCETTIPTCTNSQKLIVGHSPLSCCPQYKCDCDPLKCPSISTPECREDQ
FMIQVQQEEPCCFSPFCVCESCTKPVPLCHDGEFLTVDLNSTHFCCPQYYCVCEPNLCPM
PLLNCAEDMNLVKENVSGQCCPTWHCECNCENLVMPTCEVGEFTAIDHNFQSDCGCIQYL
CEKDDVCVFQEVSVLNPGPSMIKYLEEDFCYTIECLEEKDNHTGFHTVNFTLVNCSKKCD
VHQVYTPSPSDYDCCGTCKNVSCKFHMENGTSVVYAVGSTWHYNCTTYECVKTDEGAIIL
NYTMVCPPFNETECKMNEGIVKLYNEGCCKICKREERICQKVIIKSVIRKQDCMSQSPIN
VASCDGKCPSATIYNINIESHLRFCKCCRENGVRNLSVPLYCSGNGTEIMYTLQEPIDCT
CQWN
Download sequence
Identical sequences A0A2J8MIU3
ENSPTRP00000008931 ENSPTRP00000008931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]