SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008962 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008962
Domain Number 1 Region: 784-903,954-1145
Classification Level Classification E-value
Superfamily L domain-like 1.87e-41
Family Internalin LRR domain 0.032
Further Details:      
 
Domain Number 2 Region: 1334-1358,1393-1416
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000101
Family Motor proteins 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008962   Gene: ENSPTRG00000005271   Transcript: ENSPTRT00000009697
Sequence length 1721
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:85122161:85328497:1 gene:ENSPTRG00000005271 transcript:ENSPTRT00000009697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDDAKLKAEIEAELDKLSISSLEKEDIESDAKSETQSDDSDTDSVELPESVLHCINII
KNRSKAVEELILQDLEDTDILSCSYGAVSNNHMHLRTGLSTEYEESSEQLIKILSEIEKE
EFMRSKTDCASPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKE
LEDKEKQTLKAQRDREEKQFQEEEEKRHCWMKQFKVEKKKLENIQKQEQDKMNDELYKEE
KIWKEKFKQHEEYIRNLHLQMEEERTRFKDQQEKEKNCLLKQQNNAAVKIQAKYKAFVAY
KKYGPIIKEQIESKKRKAQEWKEKEAKIRQKEEENRKRLEEEQRIKEERKKQKEEERKRR
EKEYEEKKNIVKQEREQLISKEKIILREDASQQLIISSALKKRGYNNKHLSLEDISNDKG
DIAKNLVDQNSKKQEDVLLWLVEESNMKENVDRQTILKESIQVKLKESISSQTILADFKM
EEKNENLAKKRCSEELVKQERKYENTDNKTELGNSDLKGNLKEQFPLQELKSDAQKEEKI
MKHVINENTGQKTQIILGHNQEISEVKTNEEQKIIKDNQQKKIQKVEKEEIQEQNGLLYK
DKDTLVISVKQKSLSLTSENSKDVGENVILQEKEIYSKSKEIEETPKDNAWNSGIVIFNT
TDTMINIEGKRNDQDYVLGRHAPCEGLSNYNAESSMVSKEVNSLKSEIRNISEKCHEIAP
EPDSMTCCVSESTLLYSIEERRLAWIKSFKPWLEIFKQNQQKKIVRRKRPVKCPANMTPA
LDKLEILRCGPWDTLQQVTTVTFQDLPGCVLSTLAECTNLQFLSLRRCGLTSLHSLSNCK
KLKYIDAQENHIEAIECENLENLCVVLLNKNQLTSLHGLDGCTNIQCLELSHNKITRIGY
SFFLEENLVDNTGFCHHLGTSTSYLSLAQVWIPTGLCWSWIPITSLTKNSDCNFLISHLY
WNCGLESLKNLQQLILDHNQLINTKGLCDTPTIVYLDCSHNHLTDVEGVENCGLLQILKL
QGNYLSELPSLENLVLLRELHLDDNSISTVEAFSSYWLPLLQNITISQNSLTKIVPLFHF
VSLEKLDVSHNCLSDLKSAIKWFDACYSLHELSLTGNPLLQETNWRDSLLKVLPALRILN
GNILNSNSESRTEEHNQLGSAGFLALCQSQIREFNLLINFITGKGDVFTLDTAENLCHYF
KKLMILSTEYRHAHERGDVTITKKDESEAQKNHLAPTNSDSTLQNGIFYSCAREGEPDSP
DIPEKWMDSVSSHSPLSKSSTCENMEGRHQEILVCQKREDSKASSIPTIRIPFKEVVMTN
SLLRNHQNIEPSEKIMAAVVIQSYWRGYLMRRQIHFSTRLHTAATEGLPNSSIKNQTILK
KGKRENIVNIRKQREKAAILIQAVWKGFILRKKLTTALEAIKNEESDEEYREIDLEDFIF
DEAALEEEWLALDSTRFPSQTLLLSNQLHWPKIPGNLKWDDTSFNLPSNPAQAWLCNDKE
NLSSSEHTQFNSRSENKTSSWTPESKTSRKSLLKSEKEKKISEEWGFKDISTAQQMLKRA
QKMKSKKLKKKIDSTVRLALFKNSENKVSLPKSPKMVQPRRDGYFEGIEEDPIHKDTTAN
EKLERNREYTYQWLHTQVGVHETTSSRNMKCNHFLPELDPDVLNGGRVQLVARLVSREDT
DLDLFSMTNGSALSVNREKKNQAHRHSAGSSSKLWFPSKLI
Download sequence
Identical sequences ENSPTRP00000008962 ENSPTRP00000008962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]