SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008984 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008984
Domain Number 1 Region: 115-316
Classification Level Classification E-value
Superfamily L domain-like 9.45e-32
Family Ngr ectodomain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008984   Gene: ENSPTRG00000005287   Transcript: ENSPTRT00000009719
Sequence length 322
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:91127705:91173522:-1 gene:ENSPTRG00000005287 transcript:ENSPTRT00000009719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVDQVEIEIAT
VMPSGNRELLTPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLL
CTCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLIS
EIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLH
HLYLTDNNLDHIPLPLPENLQALHLQNNNILEMHEDTFCNVKNLTYIRKALEDIRLDGNP
INLSKTPQAYMCLPRLPVGSLV
Download sequence
Identical sequences H2Q6L1
ENSPTRP00000008984 ENSPTRP00000008984 9598.ENSPTRP00000008984 XP_001134960.1.37143 XP_003823452.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]