SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008987 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008987
Domain Number 1 Region: 31-330
Classification Level Classification E-value
Superfamily L domain-like 1.63e-47
Family Ngr ectodomain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008987   Gene: ENSPTRG00000005289   Transcript: ENSPTRT00000009722
Sequence length 338
Comment pep:known chromosome:CHIMP2.1.4:12:91274089:91282297:-1 gene:ENSPTRG00000005289 transcript:ENSPTRT00000009722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
KGLKSLEYLDLSFNQIAKLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDVKSFCKILGP
LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Download sequence
Identical sequences H2Q6L3
XP_003823450.1.60992 XP_509260.3.37143 ENSGGOP00000022526 ENSPTRP00000008987 ENSGGOP00000022526 ENSPTRP00000008987 9598.ENSPTRP00000008987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]