SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000008989 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000008989
Domain Number 1 Region: 53-346
Classification Level Classification E-value
Superfamily L domain-like 3.74e-63
Family Ngr ectodomain-like 0.00000000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000008989   Gene: ENSPTRG00000005290   Transcript: ENSPTRT00000009724
Sequence length 359
Comment pep:known chromosome:CHIMP2.1.4:12:91315932:91353116:-1 gene:ENSPTRG00000005290 transcript:ENSPTRT00000009724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKATIILLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQC
HLRVVQCSDLGLDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLHALILVNNKISKV
SPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIE
LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAAS
LKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLH
NNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
Download sequence
Identical sequences G2HIN7 P07585 Q5R1V9 Q6FH10
ENSP00000052754 ENSP00000376862 ENSP00000447654 ENSPTRP00000008989 ENSP00000376862 NP_001009082.1.37143 NP_001911.1.87134 NP_001911.1.92137 NP_598010.1.87134 NP_598010.1.92137 XP_003823449.1.60992 XP_005268750.1.92137 XP_006719333.1.92137 XP_008975306.1.60992 XP_009424245.1.37143 XP_016778090.1.37143 XP_016874406.1.92137 ENSPTRP00000008989 gi|19743846|ref|NP_598010.1| gi|4503271|ref|NP_001911.1| 9598.ENSPTRP00000008989 9606.ENSP00000052754 ENSP00000052754 ENSP00000376862 ENSP00000447654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]