SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009032 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009032
Domain Number 1 Region: 500-626
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-28
Family Netrin-like domain (NTR/C345C module) 0.084
Further Details:      
 
Domain Number 2 Region: 330-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000053
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 3 Region: 393-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 260-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000163
Family Laminin-type module 0.055
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000009032
Domain Number - Region: 99-161
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0289
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009032   Gene: ENSPTRG00000005315   Transcript: ENSPTRT00000009767
Sequence length 626
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:95909931:96041705:-1 gene:ENSPTRG00000005315 transcript:ENSPTRT00000009767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYC
FYSENTDLTCRQPKCDKCNAAHPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLE
AEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAICT
SKYSSPFPCTGGEVIFKALSPPYDTENPYSAKVREQLKITNLRVQLLKRQSCPCQRNDLN
EEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTAGS
HCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDC
QHNTEGQHCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPC
KPGVAGRHCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVH
NKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGTHV
EVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKLIV
NMKSFVQHWKPSLGRKVMDILKRECK
Download sequence
Identical sequences ENSPTRP00000009032 ENSPTRP00000009032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]