SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009268 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009268
Domain Number 1 Region: 182-308
Classification Level Classification E-value
Superfamily PH domain-like 1.49e-32
Family Pleckstrin-homology domain (PH domain) 0.0005
Further Details:      
 
Domain Number 2 Region: 343-451
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-24
Family SH2 domain 0.0000339
Further Details:      
 
Domain Number 3 Region: 24-84
Classification Level Classification E-value
Superfamily Phenylalanine zipper 7.06e-22
Family Adapter protein APS, dimerisation domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009268   Gene: ENSPTRG00000005459   Transcript: ENSPTRT00000010021
Sequence length 575
Comment pep:known chromosome:CHIMP2.1.4:12:111847187:111892904:1 gene:ENSPTRG00000005459 transcript:ENSPTRT00000010021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRA
ELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARS
SEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAK
KLLPWSLAREPPPEALKEAVLRYSLADEASMDSGARWQRGRLALRRPPGPDGPDRVLELF
DPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMA
ELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLS
CYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTE
RGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFS
LPHWDSESLPHWDSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLR
HLEPEPVNRARDSDYEMDSSSRSHLRAIDNQYTPL
Download sequence
Identical sequences H2Q6W1
ENSPTRP00000009268 ENSPTRP00000009268 XP_001145612.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]