SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009338 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009338
Domain Number 1 Region: 206-335,382-525
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.29e-33
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 117-201
Classification Level Classification E-value
Superfamily F-box domain 1.44e-21
Family F-box domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009338   Gene: ENSPTRG00000005503   Transcript: ENSPTRT00000010100
Sequence length 597
Comment pep:known chromosome:CHIMP2.1.4:12:117442922:117560876:1 gene:ENSPTRG00000005503 transcript:ENSPTRT00000010100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQGLL
EGAGRPPAARATRAEGQDVASRSRSLAREGAGGGEQLVDQLIRDLNEMNDVPFFDIQLPY
ELAINIFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLIF
QECRAKEHMLRTNWKNRKGAVSELEHVPDAVLCDVHSHDGVVIAGYTSGDVRVWDTRTWD
YVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWDLRTGKYPVHRFEHDAR
IQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRRYPVAV
AAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKILVYSLEA
GRRLLKLGNVLRDFTCVNLSDSPPNLMVSGNMDGRVRIHDLRSGNIALSLSAHQLRVSAV
QMDDWKIVSGGEEGLVSVWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNA
DLDSFTTHRRHRGLIRAYEFAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV
Download sequence
Identical sequences H2Q6Y9
ENSPTRP00000009338 9598.ENSPTRP00000009338 XP_509407.2.37143 ENSPTRP00000009338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]