SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009446 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009446
Domain Number 1 Region: 123-217
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-23
Family I set domains 0.00000346
Further Details:      
 
Domain Number 2 Region: 24-120
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-17
Family I set domains 0.00000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009446   Gene: ENSPTRG00000011477   Transcript: ENSPTRT00000010213
Sequence length 280
Comment pep:known chromosome:CHIMP2.1.4:19:59795669:59838521:1 gene:ENSPTRG00000011477 transcript:ENSPTRT00000010213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKQTTLLCLVLCLGQRIQAQEGDSPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQL
MIIKNSTYREIGRKLKFWNETDPEFIIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVT
GLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSL
GPVDLNVSGIYRCYGWYNRSPHLWSFPSNALELVVTDSIHQDYTIQNLIRMAMAGLVLVA
LLAILVENWHSHTALNKEASADVAEPRWSQQMCQPGLTFA
Download sequence
Identical sequences Q1AJL3
NP_001036089.1.37143 XP_016792325.1.37143 ENSPTRP00000009446 9598.ENSPTRP00000009446 ENSPTRP00000009446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]