SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000009958 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000009958
Domain Number 1 Region: 119-348
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.95e-71
Family Pancreatic carboxypeptidases 0.0000234
Further Details:      
 
Domain Number 2 Region: 22-110
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 3.19e-20
Family Pancreatic carboxypeptidase, activation domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000009958   Gene: ENSPTRG00000005852   Transcript: ENSPTRT00000010759
Sequence length 360
Comment pep:known_by_projection scaffold:CHIMP2.1.4:GL392075.1:6835117:6888308:1 gene:ENSPTRG00000005852 transcript:ENSPTRT00000010759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTAD
LIVKKKQVHFFVNASDVDNVKAHLNVSGIPCSVLLADVEDLIQQQISNDTVSPRASASYY
EQYHSLNEIYSWIEFITERHPDMLTKIHIGSSFEKNPLYVLKVSGKEQTAKNAIWIDCGI
HAREWISPAFCLWFIGHNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSET
YCGLYPESEPEVKAVASFLRRNINHIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVA
SEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWIYDLGIKYSVTSNPPVEKLLPLSLK
Download sequence
Identical sequences ENSPTRP00000009958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]