SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010055 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010055
Domain Number 1 Region: 122-478
Classification Level Classification E-value
Superfamily ARM repeat 1.22e-108
Family Diap1 N-terninal region-like 0.0000000106
Further Details:      
 
Domain Number 2 Region: 567-577,628-1005
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 6.02e-104
Family Formin homology 2 domain (FH2 domain) 0.00000000433
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000010055
Domain Number - Region: 555-605
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0175
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 
Domain Number - Region: 515-554
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0755
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010055   Gene: ENSPTRG00000005916   Transcript: ENSPTRT00000010863
Sequence length 1172
Comment pep:known_by_projection chromosome:CHIMP2.1.4:13:59353915:59848544:-1 gene:ENSPTRG00000005916 transcript:ENSPTRT00000010863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHRPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKFH
LNIRTLTDDMLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSENE
LLELFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFIH
ELKMGSADERLVTCLESLRVSLTSNPVSWVESFGHEGLGLLLDILEKLISGKIQEKVVKK
NQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAMDPRHPNMMTDVVKLLSAVCIVGEE
SILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSPDDLDFRLHI
RNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDVY
NMVWSTVKETRAEGYFISILQHLLLIRNDNFIRQQYFKLIDECVSQIVLHRDGMDPDFTY
RKRLDLDLTQFVDICVDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINELQ
AELQAFKSQGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFGGPVPPPPPLGFLGG
QNSPPLPILPFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCK
LENTFCCQQKARREEEDIEEKKSIKKKIKELKFLDSKIAQNLSIFLSSFRVPYEEIRMMI
LEVDETRLAESMIQNLIKHLPDQEQLNSLSQFKSEYSNLCEPEQFAVVMSNVKRLRPRLS
AILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLLELVLLMGNYMNAGSRNAQTFG
FNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKASKVSVETLEKN
LRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSIFVISAKEQYETLSKLHENMEKLYQSI
MGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLE
RQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMLKDVRQSLSPMSQRPVL
KVCNHENQKVQLTEGSRSHYNINCNSTRTPVAKELNYNLDTHTSTGRIKAAEKKEACNVE
SNRKKETELLGSFSKNESVPEVEALLARLRAL
Download sequence
Identical sequences ENSPTRP00000010055 ENSPTRP00000010055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]