SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010287 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010287
Domain Number 1 Region: 159-422
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.45e-37
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 65-126
Classification Level Classification E-value
Superfamily GLA-domain 2.94e-22
Family GLA-domain 0.00053
Further Details:      
 
Domain Number 3 Region: 115-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010287   Gene: ENSPTRG00000006051   Transcript: ENSPTRT00000011115
Sequence length 422
Comment pep:known_by_projection chromosome:CHIMP2.1.4:13:113900712:113915176:1 gene:ENSPTRG00000006051 transcript:ENSPTRT00000011115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCVPLLQGLVLVLALHRAEPSATSLKERHGLHSDSACTGVQESLFLPASKANDVLVRW
KRAGSYLLEELFEGNLEKECYEEICVYEEAREVFENEVVTDEFWRRYKGGSPCISQPCLH
NGSCQDSIWGYTCTCSPGYEGSNCELAKNECHPERTDGCQHFCLPGQESYTCSCAQGYRL
GEDHKRCVPHDQCACGVLTSEKRAPDLQDLPWQVKLTNSEGKDFCGGVVIRENFVLTTAK
CSLLHRNITVKTYFNRTSQDPLMIKITHVHVHMRYDADSEENDLSLLELEWPIQCPGAGL
PVCTPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTR
TYCERSSVAAMHWMEGSVVTREHRGSWFLTGVLGSQPVGGEAHMVLVTKVSRYSLWFKQI
MN
Download sequence
Identical sequences ENSPTRP00000010287 ENSPTRP00000010287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]