SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010301 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010301
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000051
Family TAP-C domain-like 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000010301
Domain Number - Region: 52-177
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.00432
Family Tex N-terminal region-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010301   Gene: ENSPTRG00000006059   Transcript: ENSPTRT00000011133
Sequence length 258
Comment pep:known chromosome:CHIMP2.1.4:13:114193438:114221810:-1 gene:ENSPTRG00000006059 transcript:ENSPTRT00000011133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKLKSSQKDKVRQFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVD
KKKLERLYGRYKDPQDENKIGIDGIQQFCDDLSLDPASISVLVIAWKFRAATQCEFSRKE
FLDGMTELGCDSMEKLKALLPRLEQELKDTAKFKDFYQFTFTFAKNPGQKGLDLEMAVAY
WKLVLSGRFKFLDLWNTFLLEHHKRSIPRDTWNLLLDFGDMIADDMSNYDEEGAWPVLID
DFVEYARPVVTGGKRSLF
Download sequence
Identical sequences A0A2I3S087
9598.ENSPTRP00000010301 ENSPTRP00000010301 ENSPTRP00000010301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]