SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010543 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010543
Domain Number 1 Region: 255-564
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.36e-116
Family Transglutaminase core 0.0000000197
Further Details:      
 
Domain Number 2 Region: 93-254
Classification Level Classification E-value
Superfamily E set domains 4.55e-45
Family Transglutaminase N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 690-789
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-29
Family Transglutaminase, two C-terminal domains 0.0005
Further Details:      
 
Domain Number 4 Region: 578-689
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.94e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010543   Gene: ENSPTRG00000006209   Transcript: ENSPTRT00000011396
Sequence length 818
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:23098630:23112668:-1 gene:ENSPTRG00000006209 transcript:ENSPTRT00000011396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGGRSFWARCCGCCSCRNAADD
DWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLS
SRSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGT
HVIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDP
RNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLD
ACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSV
EILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDE
NMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVES
IKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMRED
ITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVM
LTNHSSSRRTVKLHLYLSVTFYTGVSGTIFEETKKEVELAPGASDRVTMPVAYKEYRPHL
VDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPV
TLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVH
GVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA
Download sequence
Identical sequences A0A2J8QKJ9
ENSPTRP00000010543 ENSPTRP00000010543 9598.ENSPTRP00000010543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]