SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010702 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010702
Domain Number 1 Region: 105-325
Classification Level Classification E-value
Superfamily L domain-like 9.23e-30
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010702   Gene: ENSPTRG00000006313   Transcript: ENSPTRT00000011561
Sequence length 414
Comment pep:known chromosome:CHIMP2.1.4:14:48500807:48516720:1 gene:ENSPTRG00000006313 transcript:ENSPTRT00000011561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRY
ELRENIEQFFTKFVDEGKATVRLKEPPVDICLSKANSSSLKGFLSVMRLAHRGCNVDTPV
STLTPVKTSEFENFKTKMVITSKKDYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLR
KLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKA
LPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAARNKLPFLPSEFRNLSLEYLD
LFGNTFEQPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQDLDTAKICVCG
RFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK
Download sequence
Identical sequences H2Q888
ENSPTRP00000010702 ENSPTRP00000010702 XP_001143673.2.37143 XP_003831795.1.60992 9598.ENSPTRP00000010702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]