SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010724 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010724
Domain Number 1 Region: 49-276,307-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.8e-41
Family FAD-linked reductases, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010724   Gene: ENSPTRG00000006329   Transcript: ENSPTRT00000011584
Sequence length 463
Comment pep:known chromosome:CHIMP2.1.4:14:49171851:49237580:-1 gene:ENSPTRG00000006329 transcript:ENSPTRT00000011584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAALRYLVGACGRARGSFAGGSPGACGFASGRPRPLCGGSRSACTSSFDIVIVGGGIVG
LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALL
YEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVQGLRLIQQEDIKKKEPYCR
GLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKDIEMAKESPSRSIDGMQYPI
VIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNI
YPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKL
ASQHFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFV
FDAGVGDIGNHILHVRNAPSPAATSSIAISGMIADEVQQRFEL
Download sequence
Identical sequences A0A2I3SKZ1
XP_001154304.2.37143 XP_009426066.1.37143 9598.ENSPTRP00000010724 ENSPTRP00000010724 ENSPTRP00000010724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]