SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000010745 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000010745
Domain Number 1 Region: 615-774
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.69e-42
Family SPRY domain 0.0043
Further Details:      
 
Domain Number 2 Region: 433-532
Classification Level Classification E-value
Superfamily Fibronectin type III 3.38e-18
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 221-284
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000153
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2-41,125-160
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000353
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000010745
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0555
Family TFIIH p44 subunit cysteine-rich domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000010745   Gene: ENSPTRG00000006338   Transcript: ENSPTRT00000011606
Sequence length 802
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:49910850:50027700:-1 gene:ENSPTRG00000006338 transcript:ENSPTRT00000011606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQVKVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNG
GQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEDTDSEEQTLP
FPVPSERLPLRRMSPFSSTLNLQPSFPGRSYFDFRSSPHQLSLHSSLQSLNAPGCNFETQ
SAPYSQLVDIKKLLAVAWFAFDPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGVH
YWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEG
GITKGATVGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVSTLPLRLN
SCCWLPVQRLPRAVQSNQREGS
Download sequence
Identical sequences A0A2I3S2F8
ENSPTRP00000010745 ENSPTRP00000010745 9598.ENSPTRP00000010745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]