SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011076 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011076
Domain Number 1 Region: 36-221,345-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.43e-50
Family FAD-linked reductases, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011076   Gene: ENSPTRG00000006527   Transcript: ENSPTRT00000011967
Sequence length 468
Comment pep:known chromosome:CHIMP2.1.4:14:73198936:73212392:1 gene:ENSPTRG00000006527 transcript:ENSPTRT00000011967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARLVSRCGAVRAAPHSGPLASCRRWSGASTDTVYDVVVSGGGLVGAAMACALGYDIHF
HDKKILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQV
WDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSDRVTVLYRSKAIRYTWPCPF
PMADSSPWVHITLGDGSTFQTKLLIGADGHNSGVRQAVGIQNVSWNYDQSAVVATLHLSE
ATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVTMDEEKFVDAVNSAFWSD
ADHTDFIDTAGAMLQYAVSLLKPTKVSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRPR
VALIGDAAHRVHPLAGQGVNMGFGDISSLAHHLSTAAFNGKDLGSMSHLTGYETERQRHN
TALLAATDLLKRLYSTSASPLVLLRTWGLQATNAVSPLKEQIMAFASK
Download sequence
Identical sequences H2Q8L0
9598.ENSPTRP00000011076 ENSPTRP00000011076 XP_016781882.1.37143 ENSPTRP00000011076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]