SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011222 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011222
Domain Number 1 Region: 80-360
Classification Level Classification E-value
Superfamily L domain-like 1.02e-52
Family Ngr ectodomain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 417-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000189
Family Fibronectin type III 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011222
Domain Number - Region: 34-78
Classification Level Classification E-value
Superfamily L domain-like 0.000204
Family Ngr ectodomain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011222   Gene: ENSPTRG00000006600   Transcript: ENSPTRT00000012116
Sequence length 660
Comment pep:known chromosome:CHIMP2.1.4:14:84957076:85060752:1 gene:ENSPTRG00000006600 transcript:ENSPTRT00000012116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQTTKWPSHGAFFLKSWLIISLGLYSQVSKLLACPSVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREAISLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFSHLTKLKEFSIVRN
SLSHPPPDLPGTHLIRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLS
NLKQLTARNNPWFCDCSIKWVTEWLKYIPSSLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGLPLFTPAPSTASATTQPPTLSIPNPSRSYTPPNPTTSKLPTIPDWDGRERVTPP
ISERIQLSIHFVNDTSIQVSWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSL
VNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHASHLNNGSNTASSHEQTTSHSMGSP
FLLAGLIGGAVIFVLVVLLSVFCWHMHKKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
Download sequence
Identical sequences H2Q8Q8
ENSPTRP00000011222 XP_003832780.1.60992 XP_003832781.1.60992 XP_003952603.1.37143 XP_014203177.1.60992 ENSPTRP00000011222 9598.ENSPTRP00000011222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]