SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011226 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011226
Domain Number 1 Region: 68-332
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.49e-36
Family beta-glycanases 0.035
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011226
Domain Number - Region: 527-646
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0198
Family Laminin G-like module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011226   Gene: ENSPTRG00000006602   Transcript: ENSPTRT00000012120
Sequence length 662
Comment pep:known chromosome:CHIMP2.1.4:14:87393433:87458506:-1 gene:ENSPTRG00000006602 transcript:ENSPTRT00000012120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEWLLSASWQRRAKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGA
VSGGGPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPN
ITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNA
NYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDA
KLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGYMTSTIAWNLVASYYEQLPYGRCG
LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTII
IETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSERFLFKQLD
SLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYPLPPKSQPFPSTYKDDFNVDYPFFSE
APNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYNWTNLTIK
CDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWIIYALGRVE
VTAKKWYTLTLTIKGHFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQFDNFLVEA
TR
Download sequence
Identical sequences A0A2I3TU67
ENSPTRP00000011226 ENSPTRP00000011226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]