SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011321 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011321
Domain Number 1 Region: 209-355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.4e-18
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 341-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000235
Family EGF-type module 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011321
Domain Number - Region: 137-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00073
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 383-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00146
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011321   Gene: ENSPTRG00000006643   Transcript: ENSPTRT00000012222
Sequence length 545
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:91414264:91492892:-1 gene:ENSPTRG00000006643 transcript:ENSPTRT00000012222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPALSPCPLHDSLGPSGIKHPRAPRAQRRPTCPSSSGGPARELSSRLRISSSRVLDMPGI
KRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDRVSLMSPRLECNGAISAHCNLC
LPGSSDSSASTSQVAGITNIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYRGPYSNP
YSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMDESNQCVDVDECATDSHQCNPTQI
CINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFTLNEDGR
SCQDVNECATENPCVQTCVNTYGSFICRCDPGYELEEDGVHCSDMDECSFSEFLCQHECV
NQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCNLQQTCYNLQGGFKCIDPIRCEEP
YLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRSVPADIFQMQATTRYPGAYYIFQI
KSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDLEMITVNTVINFRGSSVIRLRIYV
SQYPF
Download sequence
Identical sequences 9598.ENSPTRP00000011321 ENSPTRP00000011321 ENSPTRP00000011321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]