SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011428 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011428
Domain Number 1 Region: 368-611
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.13e-21
Family Nucleotide and nucleoside kinases 0.0074
Further Details:      
 
Domain Number 2 Region: 100-348
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000000254
Family Tyrosine-dependent oxidoreductases 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011428
Domain Number - Region: 682-717
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0222
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011428   Gene: ENSPTRG00000006703   Transcript: ENSPTRT00000012342
Sequence length 723
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:96016255:96111755:1 gene:ENSPTRG00000006703 transcript:ENSPTRT00000012342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEEETAAPTEKVIRTQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENK
SAMLEASSTKVKEGTFQIVGTLSKPDSPRPDFAVETYSAISREDLLMRLLECDVIIYNIT
ESSQQTEEAIWAVSALSEEVSHFEKRKVFILLSTVMTWARSKALDPEDSEVPFTEEDYRR
RKSHPNFLDHINAEKMVLKFGKKARKFATYVVAAGLQYGAEGGMLHTFFKMAWLGEIPAL
PVFGDGTNVIPTIHVLDLAGVIQNVIDHVPKPHYLVAVDESVHTLEDIVKCISKNTGPGK
IQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWAAQTGFVENINTILKEYK
QSRGLMPIKICILGPPAVGKSSVAEELAKYYKLHHIQLKDVISEAIAKLEAIVAPNNVGE
GDEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYIL
DGFPKTYDQAKDLFNQEDEEEEDEVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPE
SIVAGTHYSQDRFLRALSNYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQ
LIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNK
RLEEVKREKRELLEAQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFKNNP
EAQ
Download sequence
Identical sequences ENSPTRP00000011428 ENSPTRP00000011428 9598.ENSPTRP00000011428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]