SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011443 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011443
Domain Number 1 Region: 590-698
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 184-503
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 1.14e-22
Family Soluble quinoprotein glucose dehydrogenase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011443   Gene: ENSPTRG00000006712   Transcript: ENSPTRT00000012358
Sequence length 701
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:99320732:99349562:1 gene:ENSPTRG00000006712 transcript:ENSPTRT00000012358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARARAGALLALWVLGAAAHPQCLDFRPPFRPPQPLRLCAQYSDFGCCDEGRDAELTRRF
WALASRVDAAEWAACAGYARDLLCQECSPYAAHLYDAEDPFTPLRTVPGLCQDYCLDMWH
KCRGLFRHLSTDQELWALEGNRARFCRYLSLDDTDYCFPYLLVNKNLNSNLGHVVADAKG
CLQLCLEEVANGLRNPVAMVHARDGTHRFFVAEQVGLVWAYLPDRSRLGKPFLNISRVVL
TSPWEGDERGFLGIAFHPSFRHNRRLYVYYSVGIRSSEWIRISEFRVSEDDENAVDHSSE
RIILEVKEPASNHNGGQLLFGDDGYLYIFTGDGGMAGDPFGTFGNAQNFGRGDPSSGGGR
GGLFLGDVGQNKFEEVDLVEGGGNYGWRAGEGFEWYGRSLWANPSFNDLLPIFAYSHTVG
KSVTGGYVYRGCEYPNLNGLYIFGDFMSGRLMSLQENPGTGQWQYSEICMGHGQTCEFPG
LINNYYPYIISFGEDEAGELYFMSTGEPSATAPRGVVYKIIDASFIPKTRSTPRPTARAP
TRAPRRGRPTAAPPAPTPRPARPTQQPGSRRGGGRRRGRLNSASRAFRDGEVRLVRPAGL
SSGSGRVEVFVGGRWGTVCDDSWNISGAAVVCRQLGFAYAVRAVKRAEFGQGGSLPILLD
DVRCAGWERNLLECQHNGVGTHNCEHDEDAGVVCSHQNPDL
Download sequence
Identical sequences ENSPTRP00000011443 ENSPTRP00000011443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]