SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011587 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011587
Domain Number 1 Region: 455-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000324
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 2 Region: 234-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000156
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 3 Region: 568-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000877
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 4 Region: 605-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000185
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 5 Region: 346-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000205
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 6 Region: 271-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000041
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 7 Region: 309-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 8 Region: 490-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000392
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000011587
Domain Number - Region: 420-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000248
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011587   Gene: ENSPTRG00000006784   Transcript: ENSPTRT00000012518
Sequence length 1016
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:104883956:104908241:-1 gene:ENSPTRG00000006784 transcript:ENSPTRT00000012518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FELQLSALRNVNGELLSGACCDGDGRPTRAGGCGHDECDTYVRVCLKEYQAKVTPTGPCS
YGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAW
DWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNK
FCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECIDECASN
PCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCIPG
WKGINCHINVNDCHGQCQHGGTCKDLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGL
CEDLADGFHCHCPQGFSGPLCECPDDFGGNCSVPLPCPGGACRVIDGCGSDAGPGMPGTA
ASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCF
CPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGRKGKTCHSRFQCDTNTCT
NWCTCYYSGDTLRCACPPSNVSTCAINTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGP
DCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPHG
SSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPP
CEAWGECGAEEPPSTPCLPRSGHLDNNCARLTLRFNRDHVPQGTTVGAICSGIRSLPATR
AVARDRLLVLLCDRASSGASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGNSSLL
LAVTEVKVETVVTGGSSTGLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLPREE
SANNQWAPLNPIRNPIERPGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDEEDED
LGRGEEDFLEAEKFLSHKFTKDPGRSPGRPGHWASVPKVDNRAVRSINEARYAGKE
Download sequence
Identical sequences 9598.ENSPTRP00000011587 ENSPTRP00000011587 ENSPTRP00000011587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]