SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000011848 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000011848
Domain Number 1 Region: 122-302
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-42
Family CBM11 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000011848   Gene: ENSPTRG00000006945   Transcript: ENSPTRT00000012799
Sequence length 327
Comment pep:known chromosome:CHIMP2.1.4:15:38290654:38305955:-1 gene:ENSPTRG00000006945 transcript:ENSPTRT00000012799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQ
GDHQKEVALDITSSEEKPDVSFDKAIRDEAMYHFRHLKDEIVDHWRGPEGHPLHEVLLEQ
AKVVWQFRGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRS
GYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYF
MFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKISSIGFTLADKVDGPFFLEIDF
IGVFTDPAHTEEFAYENSPELNPRLFK
Download sequence
Identical sequences H2Q979
ENSPTRP00000011848 ENSPTRP00000011848 XP_003826659.1.60992 XP_008950242.1.60992 XP_009427023.1.37143 XP_009427025.1.37143 9598.ENSPTRP00000011848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]