SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012002 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012002
Domain Number 1 Region: 317-498
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.13e-62
Family SPRY domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 33-105
Classification Level Classification E-value
Superfamily RING/U-box 2.42e-16
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000012002
Domain Number - Region: 112-140
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000244
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012002   Gene: ENSPTRG00000007022   Transcript: ENSPTRT00000012961
Sequence length 500
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:41865283:41901824:1 gene:ENSPTRG00000007022 transcript:ENSPTRT00000012961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSTNPSSNIDPGNYVEMNDSITHLPSKVVIQDITMELHCPLCNDWFRDPLMLSCGHNF
CQACIQDFWRLQAKETFCPECKMLCQYSNCTFNPVLDKLVEKIKKLPLLKGHPQCLEHGE
NLKLFSKPDGKLICFQCKDARLSVGQSKEFLQISDAVRFFTEELAIQQGQLETTLKELQT
LRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELLEEGKALNEEMELNL
SQLQERCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLG
QYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGDIKKVMPDDPER
FDSSVAVLGSRGFTSGKWYWEVEVAKKTKWTVGVVRESIIRKGSCPLTPEQGFWLLRLRN
QTDLKALDLPSCSLTLTNNLDKVGIYLDYEGGQLSFYNAKTMTHIYTFSNTFMEKLYPYF
CPCLNDGGENKEPLHILHPQ
Download sequence
Identical sequences A0A2I3S6G6
ENSPTRP00000012002 XP_016782580.1.37143 ENSPTRP00000012002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]