SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012322 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000012322
Domain Number - Region: 24-142
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000166
Family G proteins 0.0087
Further Details:      
 
Domain Number - Region: 263-304
Classification Level Classification E-value
Superfamily Globin-like 0.0665
Family Globins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012322   Gene: ENSPTRG00000007202   Transcript: ENSPTRT00000013296
Sequence length 315
Comment pep:known chromosome:CHIMP2.1.4:15:64683313:64741789:-1 gene:ENSPTRG00000007202 transcript:ENSPTRT00000013296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVPCALVTSCSSAFSGDQLVQHILGTEDLIVEVTSNDAVRFYPWTIDNKYYSADINL
CVVPNKFLVTAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAKAWLPEVMILVCDRVSED
GINRQKAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDR
NQGFSLLNSLTGTNHSIGSADPCHPEQPHLPAADSTESLSDHRGGASNTTDAQVDSIVDP
MLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG
GDRDEIEGLSSDEEH
Download sequence
Identical sequences H2Q9N9
ENSPTRP00000012322 ENSPTRP00000012322 9598.ENSPTRP00000012322 XP_001174780.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]