SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012374 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012374
Domain Number 1 Region: 65-305
Classification Level Classification E-value
Superfamily L domain-like 9.18e-33
Family Internalin LRR domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012374   Gene: ENSPTRG00000007236   Transcript: ENSPTRT00000013352
Sequence length 686
Comment pep:known chromosome:CHIMP2.1.4:15:68435523:68599594:1 gene:ENSPTRG00000007236 transcript:ENSPTRT00000013352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPGKYRSVSGRAANNVNCGLHLVIQTSSLPEKNKVEFKLNKDTSSFPGRLLQHDLERNY
SSRQGDHINLVSSSLSSFPILQRSSEEKILYSDRLSLERQKLTVCPIINGEDHLRLLNFQ
HNFITRIQNISNLQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISNLENLKSL
DVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDV
DNLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQ
LDMKRITEEERRMASVLAKKEEEKKRESHKQSLLKEKRRLTINNVARQWDLQQQRVANIA
TNEDRKDSDSPQDPCQIDGSTLSAFPEETGPLDSGLNNALQGLSVIDTYLVEVDGDTLSL
YGSGALESLDRNWSVQTAGMITTVSFTFIEFDEIVQVLPKLKIKFPNSLHLKFKETNLVM
LQQFNALAQLRRIDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMA
ERLFGILAHVASSELPQYRLISILGDARKKQFQYLLESKGKKPGIINEENNDSKRLVGEN
TNRATLNYTTRDFYNEKLEEIKEKKKFCKTYIEDLVKEATEINMKNEALQKLWPQMFIEL
VRDAVIEIRNKNSYMKLCLQQITDQK
Download sequence
Identical sequences G2HIW9
ENSPTRP00000012374 NP_001233293.1.37143 ENSPTRP00000012374 9598.ENSPTRP00000012374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]