SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012489 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012489
Domain Number 1 Region: 496-912
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.08e-95
Family alpha-mannosidase, C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 138-391
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.96e-76
Family alpha-mannosidase 0.013
Further Details:      
 
Domain Number 3 Region: 392-493
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 6.54e-25
Family alpha-mannosidase, domain 2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000012489
Domain Number - Region: 71-117
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0404
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012489   Gene: ENSPTRG00000007299   Transcript: ENSPTRT00000013473
Sequence length 916
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:72909632:72921895:-1 gene:ENSPTRG00000007299 transcript:ENSPTRT00000013473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPALKHWRTTLERVEKFVSPLYFTDCNLRGRLFGASCPVAVLSSFLTPERLPYQEAV
QRDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQGLT
KEGEKTSYVLTDRLGERDPRWLWPFKETVRKCARSWVTALQLMERNPEFIFACSQAQQLE
WVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQEFGKM
CSEFWLPDTFGYSAQLPQIMHGCGIRRFLTQKLSWNLVNSFPHHTFFWEGLDGSRVLVHF
PPGDSYGMQGSVEEVLKTVANNRDKGRANHSAFLFGFGDGGGGPTQTMLDRLKRLSNTDG
LPRVQLSSPRQLFSALESDSEQLCTWVGELFLELHNGTYTTHAQIKKGNRECERILHDVE
LLSSLALARSAQFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQMVAEEAMCHYEDIRSHGN
TLLSAAAAALCAGEPGPEGLLIVNTLPWKRTEVMALPKPGGAHSLALVTVPSMGYAPVPP
PTSLQPLLPQQPVFVVQETDGSVTLDNGIIRVKLDPTGRLTSLVLVASGREAIAEGAVGN
QFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGLRGSAWFLLQISPNSRLS
QEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYNTSWD
WARFEVWAHRWMDLSEHGFGLALLNDCKYGASVRGSILSLSLLRAPKAPDATADTGRHEF
TYALMPHKGSFQDAGVIQAAYSLNFPLLALPAPSPAPATSWSAFSVSSPAVVLETVKQAE
SSPQRRSLVLRLYEAHGSHVDCWLHLSLPVQEAILCDLLERPDPAGHLTLRDNRLKLTFS
PFQVLSLLLVLQPPPH
Download sequence
Identical sequences ENSPTRP00000012489 ENSPTRP00000012489 9598.ENSPTRP00000012489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]