SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012503 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012503
Domain Number 1 Region: 28-69
Classification Level Classification E-value
Superfamily F-box domain 0.00000000798
Family F-box domain 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000012503
Domain Number - Region: 302-385
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00173
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012503   Gene: ENSPTRG00000007311   Transcript: ENSPTRT00000013488
Sequence length 403
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:73455833:73487269:1 gene:ENSPTRG00000007311 transcript:ENSPTRT00000013488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVL
RTHRSVTWISAGVAEAGHLERHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGH
KRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFP
QIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVV
STFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEK
TAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFGN
GEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK
Download sequence
Identical sequences 9598.ENSPTRP00000012503 ENSPTRP00000012503 ENSPTRP00000012503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]