SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012615 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012615
Domain Number 1 Region: 566-703
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-29
Family SPRY domain 0.0013
Further Details:      
 
Domain Number 2 Region: 371-563
Classification Level Classification E-value
Superfamily Fibronectin type III 1.56e-25
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 3 Region: 173-223
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000071
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012615   Gene: ENSPTRG00000007383   Transcript: ENSPTRT00000013606
Sequence length 703
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:80328779:80356320:-1 gene:ENSPTRG00000007383 transcript:ENSPTRT00000013606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEESGEELGLDRSTPKDFHFYHMDLYDSEDRLHLFPEENTRMRKVVQAEMANESRGAGD
GKAQRDLQEEVDELVHLYGLEDDHELGNEFVDENIPRTGVSEYPPYMMKRRDPAREQRDW
RLSGEAAEAEDLGFGGWGSAGQCQDLREAYRYTHGRASEEYECYVIPEEEDEEEAADVFC
VTCKTPIRAFQKVFDEHKEHEVIPLNEALESAKDEIHKNMYKLEKQIIEMENFANHLEEV
FITVEENFGKQEQNFESHYTEILETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGENLD
TCKELMETIEEMCHEEKVDFIKDAVAMADRLGKFLKTKTDVEISAQPEFEDQTLDFSDVE
QLMGSINTIPAPSAPVINPQVPNSATGSSVRVCWSLYSDDTVESYQLSYRPVQDSSPGKD
QAEFTVTVKETYCSVTNLVPNTQYEFWVTAHNRAGPSPSSERAVYMTAPSPPIIKTKEIR
SCEEAVLICWESGNLNPVDSYTVELTQAESPEASGVTESVVGIPTCESVVQLQPGRSYII
YVRALNMGGPSVRSEPATVHTIGSYFRLNKDTCHPWLTISEDGLTVVRSERRTPARELSP
SDTHFTRCVAVMGNLIPVRGHHYWEVEVDEHLDYRVGVAFADAPKQEDLGANCLSWCMRH
TFASSRHKYEFLHNRTTPDIRITVPPKKIGILLDYEHSKLSFF
Download sequence
Identical sequences ENSPTRP00000012615 ENSPTRP00000012615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]