SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000012686 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000012686
Domain Number 1 Region: 2015-2159
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-42
Family C-type lectin domain 0.000000351
Further Details:      
 
Domain Number 2 Region: 477-584
Classification Level Classification E-value
Superfamily C-type lectin-like 8.61e-42
Family Link domain 0.0017
Further Details:      
 
Domain Number 3 Region: 150-260
Classification Level Classification E-value
Superfamily C-type lectin-like 8.48e-40
Family Link domain 0.0015
Further Details:      
 
Domain Number 4 Region: 588-701
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-30
Family Link domain 0.0045
Further Details:      
 
Domain Number 5 Region: 261-355
Classification Level Classification E-value
Superfamily C-type lectin-like 4.81e-28
Family Link domain 0.0024
Further Details:      
 
Domain Number 6 Region: 33-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000356
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 
Domain Number 7 Region: 2160-2220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000012686   Gene: ENSPTRG00000007424   Transcript: ENSPTRT00000013686
Sequence length 2245
Comment pep:known_by_projection chromosome:CHIMP2.1.4:15:86175211:86212839:1 gene:ENSPTRG00000007424 transcript:ENSPTRT00000013686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLWVFVTLRVITAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEV
QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTF
APEIGATAFPEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF
HYRPGPTRYSLTFEEAQQACLHTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS
PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDRLEGEVFFATRLEQFTFQEALEFCES
HNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQT
GLPDPLSRHHAFCFRGISAVPSPGEEEGGTPTSPSGVEEWIATQVVPGVAAVPVEEETTA
VPSGETTAILEFTTEPENQTEWEPAYTPVGTSPLPGILPTWPPTGAATEESTEGPSATEV
PSASEEPSPSEVPFPSEEPSPSEEPFPSVRPFPSVELFPSEEPFPSKEPSPSEEPSASEE
PYTPSPPVPSWTELPSSGEESGAPDVSGDFIGSGDVSGHLDFSGQLSGDRASGLPSGDLD
SSGLTSTVGSVLPVESGLPSGDEERIEWPSTPTVGELPSGAEILEGSASGVGDLSGLPSG
EVLETSASGVGDLSGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVL
ETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETT
APGVEDISGLPSGEVLETTAPGVEDISGLPSGEVLETTASGVEDISGLPSGEVLETTAPG
VEEISGLPSGEVLETTASGVEEISGLPSGEVLETSTSAVGDVSGPPSGGEVLEISASGVE
DISGLPSGEVVETSASGIEDVSELPSGEGLETSASGVEDLSRLPSGEEVLEISASGFGDL
SGLPSGGEGLETSASEVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGSASGDLD
LGKLPSGTLGSGQAPETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDST
LVEVVTASTASELEGRGTIGISGAGEISGLPSSELDISGRASGLPSGTELSGQASGSPDV
SGEIPGLFGVSGQPSGFPDTSGETSGVTELSGLSSGQPGVSGEASGVLYGTSQPFGITDL
SGETSGVPDLSGQPSGLPGFSGATSGVPDLVSGTTSGSGESSGITFVDTSLVEVAPTTFK
EEEGLGSVELSGLPSGEADLSGKSGMVDVSGQFSGTVNSSGFTSQTPEFSGLPSGIAEVS
GESSRAEIGSSLPSGAYYGSGTPSSFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILELS
GAHSGAPDMSGEHSGFLDLSGLQSGLVEPSGEPPGTPYFSGDFASTTNVSRESSVAMGTS
GEASGLPEVTLITSEFVEGVTEPTVSQELGQRPPVTHTPQLFESSGDVSTAGDVSGATPV
LPGSGVEVSSVPESSSETSAYPEAGFGASAAPEASREDSGSPDLSETTSAFHEADLERSS
GLGVSGSTLTFQEGEASAAPEVSGESTTTNDVGTEAPGLPSATPTASGDRTEISGDPSGH
TLRLGVVISTSIPESEWTQQTQRPAETHLEIESSSLLYSGEETHTVKTATSPTDASIPAS
PEWKRESESTAAAPARSCAEEPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWN
KYQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIE
GDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTV
ACGEPPVVEHARTFGQKKDRYEINSLVRYQCTEGFVQRHMPTIRCQPSGHWEEPRITCTD
PTTYKRRLQKRSSRHPRRSRPSTAH
Download sequence
Identical sequences ENSPTRP00000012686 ENSPTRP00000012686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]